| Desktop | 0/100 | ✘ |
| Mobile | 25/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 4090 KB | ✘ |
| Compression | 306 KB (-92.5%) | ✔ |
| Text/Html Ratio | 17416 / 4187840 (bytes) = 0.42% | ✘ |
| Load Time | 2.73 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 33 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 3 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| apply | 108 | ✘ | ✘ | ✘ |
| college | 83 | ✘ | ✘ | ✘ |
| javascript | 80 | ✘ | ✘ | ✘ |
| required | 80 | ✘ | ✘ | ✘ |
| nursing | 47 | ✘ | ✘ | ✘ |
| dental | 31 | ✘ | ✘ | ✘ |
| bangalore | 26 | ✔ | ✔ | ✘ |
| admission | 18 | ✔ | ✘ | ✘ |
| direct | 15 | ✘ | ✘ | ✘ |
| nagar | 13 | ✘ | ✘ | ✘ |
| pradeshandaman | 13 | ✘ | ✘ | ✘ |
| -andhra | 13 | ✘ | ✘ | ✘ |
| select | 13 | ✘ | ✘ | ✘ |
| pradeshjammu | 13 | ✘ | ✘ | ✘ |
| andkashmirjharkhandkarnatakakeralaladakhlakshadweepmadhyapradeshmaharashtramanipurmeghalayamizoramnagalandodishapondicherrypunjabrajasthansikkimtamilnadutelanganatripurauttar | 13 | ✘ | ✘ | ✘ |
|
With 2.73 seconds in page load, 4090 KB of page size and all other reports below, the careermudhra.com has a SEO score of 69 out of 100 |
| Title | Best Career Counselling And Admission Consultants In Bangalore 2023 |
| Description | Know everything about the best career counselling and guidance center in Bangalore. CareerMudhra.com is the best educational portal in India. |
| Keyword |
| Age | 4 Years, 111 Days |
| Created | 23rd-Dec-2019 |
| Updated | 5th-Dec-2023 |
| Expiry | 23rd-Dec-2024 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| careermudhra.com | A | 14374 | ip:35.200.241.195 |
| careermudhra.com | NS | 21600 | target:ns-cloud-e4.googledomains.com |
| careermudhra.com | NS | 21600 | target:ns-cloud-e1.googledomains.com |
| careermudhra.com | NS | 21600 | target:ns-cloud-e2.googledomains.com |
| careermudhra.com | NS | 21600 | target:ns-cloud-e3.googledomains.com |
| careermudhra.com | SOA | 21600 | mname:ns-cloud-e1.googledomains.comrname:cloud-dns-hostmaster.google.comserial:1refresh:21600retry:3600expire:259200minimum-ttl:300 |
| careermudhra.com | MX | 86400 | pri:1target:aspmx.l.google.com |
| careermudhra.com | MX | 86400 | pri:10target:alt3.aspmx.l.google.com |
| careermudhra.com | MX | 86400 | pri:5target:alt2.aspmx.l.google.com |
| careermudhra.com | MX | 86400 | pri:10target:alt4.aspmx.l.google.com |
| careermudhra.com | MX | 86400 | pri:5target:alt1.aspmx.l.google.com |
| careermudhra.com | TXT | 14400 | txt:facebook-domain-verification=d9edvtbfirmd0nr8c2kiekt77foxvj |
|
HTTP/1.1 301 Moved Permanently Connection: Keep-Alive Keep-Alive: timeout=5, max=100 content-type: text/html content-length: 707 date: Fri, 12 Apr 2024 11:39:19 GMT server: LiteSpeed location: https://careermudhra.com/ HTTP/2 200 cache-control: no-cache, must-revalidate, max-age=0 pragma: no-cache expires: Wed, 11 Jan 1984 05:00:00 GMT content-type: text/html; charset=UTF-8 vary: Accept-Encoding last-modified: Fri, 12 Apr 2024 10:41:03 GMT content-length: 4187840 date: Fri, 12 Apr 2024 11:39:20 GMT server: LiteSpeed |
|
Domain Name: CAREERMUDHRA.COM Registry Domain ID: 2470710082_DOMAIN_COM-VRSN Registrar WHOIS Server: Whois.bigrock.com Registrar URL: www.bigrock.com Updated Date: 2023-12-05T15:02:12Z Creation Date: 2019-12-23T08:41:24Z Registrar Registration Expiration Date: 2024-12-23T08:41:24Z Registrar: BigRock Solutions Ltd. Registrar IANA ID: 1495 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Vishnu Nambiar Registrant Organization: Registrant Street: Shree House Near Collectors Bungalow Registrant City: Calicut Registrant State/Province: Kerala Registrant Postal Code: 673005 Registrant Country: IN Registrant Phone: +91.9901532255 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: kvishnu.nambiar@gmail.com Registry Admin ID: Not Available From Registry Admin Name: Vishnu Nambiar Admin Organization: Admin Street: Shree House Near Collectors Bungalow Admin City: Calicut Admin State/Province: Kerala Admin Postal Code: 673005 Admin Country: IN Admin Phone: +91.9901532255 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: kvishnu.nambiar@gmail.com Registry Tech ID: Not Available From Registry Tech Name: Vishnu Nambiar Tech Organization: Tech Street: Shree House Near Collectors Bungalow Tech City: Calicut Tech State/Province: Kerala Tech Postal Code: 673005 Tech Country: IN Tech Phone: +91.9901532255 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: kvishnu.nambiar@gmail.com Name Server: ns-cloud-e1.googledomains.com Name Server: ns-cloud-e2.googledomains.com Name Server: ns-cloud-e3.googledomains.com Name Server: ns-cloud-e4.googledomains.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse@bigrock.com Registrar Abuse Contact Phone: +1-415-349-0015 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-04-12T11:39:30Z |
| Server IP | 35.200.241.195 |
| Server Location | Asia |
| Service Provider | GOOGLE-CLOUD-PLATFORM |
| Domains (TLD) | Status |
|---|---|
| careermudhra.net | Available |
| careermudhra.org | Already Registered |
| careermudhra.biz | Available |
| careermudhra.io | Already Registered |
| careermudhra.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| carermudhra.com | Available |
| xareermudhra.com | Available |
| sareermudhra.com | Available |
| dareermudhra.com | Available |
| fareermudhra.com | Available |
| Twinkleintime.com |
| Ninadue.com |
| Iqtennis.com.au |
| Taeh.ca |
| Thejointfranchise.com |
| Nuttynutnewsnetwork.co.uk |
| Wpcrack.in |
| Inceptioeditions.com |
| Techtalkyt.com |
| Toptennisnews.com |